a44421a79fb36cc2036fe116b97ea3bc9590cd0c
braney
  Fri Dec 2 09:34:39 2011 -0800
removed rcsid (#295)
diff --git src/lib/blastParse.c src/lib/blastParse.c
index db82aff..a251ddb 100644
--- src/lib/blastParse.c
+++ src/lib/blastParse.c
@@ -1,898 +1,897 @@
 /* blastParse - read in blast output into C data structure. */
 
 #include "common.h"
 #include "dystring.h"
 #include "linefile.h"
 #include "dnautil.h"
 #include "sqlNum.h"
 #include "blastParse.h"
 #include "verbose.h"
 
-static char const rcsid[] = "$Id: blastParse.c,v 1.25 2010/01/06 21:09:18 markd Exp $";
 
 #define WARN_LEVEL 1   /* verbose level to enable warnings */
 #define TRACE_LEVEL 3  /* verbose level to enable tracing of files */
 #define DUMP_LEVEL 4   /* verbose level to enable dumping of parsed */
 
 struct blastFile *blastFileReadAll(char *fileName)
 /* Read all blast alignment in file. */
 {
 struct blastFile *bf;
 struct blastQuery *bq;
 
 bf = blastFileOpenVerify(fileName);
 while ((bq = blastFileNextQuery(bf)) != NULL)
     {
     slAddHead(&bf->queries, bq);
     }
 slReverse(&bf->queries);
 lineFileClose(&bf->lf);
 return bf;
 }
 
 static void bfError(struct blastFile *bf, char *message)
 /* Print blast file error message. */
 {
 errAbort("%s:%d: %s", bf->fileName, bf->lf->lineIx, message);
 }
 
 static void bfWarn(struct blastFile *bf, char *message)
 /* Print blast file warning message. */
 {
 verbose(WARN_LEVEL, "Warning: %s:%d: %s\n", bf->fileName, bf->lf->lineIx, message);
 }
 
 static void bfUnexpectedEof(struct blastFile *bf)
 /* generate error on unexpected EOF */
 {
 errAbort("Unexpected end of file in %s\n", bf->fileName);
 }
 
 static void bfSyntax(struct blastFile *bf)
 /* General error message. */
 {
 bfError(bf, "Can't cope with BLAST output syntax");
 }
 
 static boolean isAllDigits(char *s)
 /* test if a string is all digits */
 {
 for (; *s != '\0'; s++)
     {
     if (!isdigit(*s))
         return FALSE;
     }
 return TRUE;
 }
 
 static boolean isAllDashes(char *s)
 /* test if a string is all dashes */
 {
 for (; *s != '\0'; s++)
     {
     if (*s != '-')
         return FALSE;
     }
 return TRUE;
 }
 
 static char *bfNextLine(struct blastFile *bf)
 /* Fetch next line of input trying, or NULL if not found */
 {
 char *line = NULL;
 if (lineFileNext(bf->lf, &line, NULL))
     {
     verbose(TRACE_LEVEL, "    => %s\n", line);
     return line;
     }
 else
     {
     verbose(TRACE_LEVEL, "    => EOF\n");
     return NULL;
     }
 }
 
 static boolean bfSkipBlankLines(struct blastFile *bf)
 /* skip blank lines, return FALSE on EOF */
 {
 char *line = NULL;
 while ((line = bfNextLine(bf)) != NULL)
     {
     if (skipLeadingSpaces(line)[0] != '\0')
         {
 	lineFileReuse(bf->lf);
         return TRUE;
         }
     }
 return FALSE; /* EOF */
 }
 
 static char *bfNeedNextLine(struct blastFile *bf)
 /* Fetch next line of input or die trying. */
 {
 char *line = bfNextLine(bf);
 if (line == NULL)
     bfUnexpectedEof(bf);
 return line;
 }
 
 static char *bfSearchForLine(struct blastFile *bf, char *start)
 /* scan for a line starting with the specified string */
 {
 for (;;)
     {
     char *line = bfNextLine(bf);
     if (line == NULL)
 	return NULL;
     if (startsWith(start, line))
         return line;
     }
 }
 
 static void bfBadHeader(struct blastFile *bf)
 /* Report bad header. */
 {
 bfError(bf, "Bad first line\nShould be something like:\n"
             "BLASTN 2.0.11 [Jan-20-2000]");
 }
 
 struct blastFile *blastFileOpenVerify(char *fileName)
 /* Open file, read and verify header. */
 {
 struct blastFile *bf;
 char *line;
 char *words[16];
 int wordCount;
 struct lineFile *lf;
 
 AllocVar(bf);
 bf->lf = lf = lineFileOpen(fileName, TRUE);
 bf->fileName = cloneString(fileName);
 
 /* Parse first line - something like: */
 line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if (wordCount < 3)
     bfBadHeader(bf);
 bf->program = cloneString(words[0]);
 bf->version = cloneString(words[1]);
 bf->buildDate = cloneString(words[2]);
 if (!wildMatch("*BLAST*", bf->program))
     bfBadHeader(bf);
 if (!isdigit(bf->version[0]))
     bfBadHeader(bf);
 if (bf->buildDate[0] != '[')
     bfBadHeader(bf);
 return bf;
 }
 
 void decomma(char *s)
 /* Remove commas from string. */
 {
 char *d = s;
 char c;
 
 for (;;)
     {
     c = *s++;
     if (c != ',')
 	*d++ = c;
     if (c == 0)
 	break;
     }
 }
 
 static void parseQueryLines(struct blastFile *bf, char *line, struct blastQuery *bq)
 /* Parse the Query= lines */
 {
 char *s, *e;
 char *words[16];
 int wordCount;
 if (bq->query != NULL)
     bfError(bf, "already parse Query=");
 
 /* Process something like:
  *    Query= MM39H11    00630     
  */
 wordCount = chopLine(line, words);
 if (wordCount < 2)
     bfError(bf, "No sequence name in query line");
 bq->query = cloneString(words[1]);
 
 for (;;)
     {
     line = bfNeedNextLine(bf);
     s = skipLeadingSpaces(line);
     if (s[0] == '(')
         break;
     }
 if (!isdigit(s[1]))
     {
     bfError(bf, "expecting something like:\n"
                 "   (45,693 letters)");
     }
 s += 1;
 if ((e = strchr(s, ' ')) == NULL)
     {
     bfError(bf, "expecting something like:\n"
                 "   (45,693 letters)");
     }
 *e = 0;
 decomma(s);
 bq->queryBaseCount = atoi(s);
 }
 
 static void parseDatabaseLines(struct blastFile *bf, char *line, struct blastQuery *bq)
 /* Process something like:
  * Database: chr22.fa 
  *        977 sequences; 95,550,797 total letters
  */
 {
 static struct dyString *tmpBuf = NULL;
 char *words[16];
 int wordCount;
 if (bq->database != NULL)
     bfError(bf, "already parse Database:");
 
 if (tmpBuf == NULL)
     tmpBuf = dyStringNew(512);
 
 /* parse something like
  * Database: celegans98
  * some versions of blastp include the absolute path, but
  * then split it across lines.
  */
 wordCount = chopLine(line, words);
 if (wordCount < 2)
     bfError(bf, "Expecting database name");
 dyStringClear(tmpBuf);
 dyStringAppend(tmpBuf, words[1]);
 while (line = bfNeedNextLine(bf), !isspace(line[0]))
     {
     dyStringAppend(tmpBuf, line);
     }
 bq->database = cloneString(tmpBuf->string);
 
 /* Process something like:
  *        977 sequences; 95,550,797 total letters
  */
 wordCount = chopLine(line, words);
 if (wordCount < 3 || !isdigit(words[0][0]) || !isdigit(words[2][0]))
     bfError(bf, "Expecting database info");
 decomma(words[0]);
 decomma(words[2]);
 bq->dbSeqCount = atoi(words[0]);
 bq->dbBaseCount = atoi(words[2]);
 }
 
 static char *roundLinePrefix = "Results from round "; // start of a round line
 
 static boolean isRoundLine(char *line)
 /* check if a line is a PSI round number line */
 {
 return startsWith(roundLinePrefix, line);
 }
 
 static void parseRoundLine(char *line, struct blastQuery *bq)
 /* round line and save current round in query
  *   Results from round 1
  */
 {
 char *p = skipLeadingSpaces(line + strlen(roundLinePrefix));
 bq->psiRounds = atoi(p);
 }
 
 struct blastQuery *blastFileNextQuery(struct blastFile *bf)
 /* Read all alignments associated with next query.  Return NULL at EOF. */
 {
 char *line;
 struct blastQuery *bq;
 struct blastGappedAli *bga;
 AllocVar(bq);
 
 verbose(TRACE_LEVEL, "blastFileNextQuery\n");
 
 /* find and parse Query= */
 line = bfSearchForLine(bf, "Query=");
 if (line == NULL)
     return NULL;
 parseQueryLines(bf, line, bq);
 
 /* find and parse Database: */
 line = bfSearchForLine(bf, "Database:");
 if (line == NULL)
     bfUnexpectedEof(bf);
 parseDatabaseLines(bf, line, bq);
 
 /* Seek to beginning of first gapped alignment. */
 for (;;)
     {
     line = bfNeedNextLine(bf);
     if (line[0] == '>')
 	{
 	lineFileReuse(bf->lf);
 	break;
 	}
     else if (isRoundLine(line))
         parseRoundLine(line, bq);
     else if (stringIn("No hits found", line) != NULL)
         break;
     }
 
 /* Read in gapped alignments. */
 while ((bga = blastFileNextGapped(bf, bq)) != NULL)
     {
     slAddHead(&bq->gapped, bga);
     }
 slReverse(&bq->gapped);
 if (verboseLevel() >= DUMP_LEVEL)
     {
     verbose(DUMP_LEVEL, "blastFileNextQuery result:\n");
     blastQueryPrint(bq, stderr);
     }
 return bq;
 }
 
 static char *findNextGapped(struct blastFile *bf, struct blastQuery *bq)
 /* scan for next gapped alignment, return line or NULL if not hit */
 {
 while (TRUE)
     {
     if (!bfSkipBlankLines(bf))
         return NULL;
     char *line = bfNextLine(bf);
     /*
      * the last condition was added to deal with the new blast output format and is meant to find lines such as this one:
      * TBLASTN 2.2.15 [Oct-15-2006]
      * I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc
      */
     if (startsWith("  Database:", line) || (stringIn("BLAST", line) != NULL))
         {
 	lineFileReuse(bf->lf);
         return NULL;
         }
     if (line[0] == '>')
         return line;
     if (isRoundLine(line))
         parseRoundLine(line, bq);
     }
 }
 
 struct blastGappedAli *blastFileNextGapped(struct blastFile *bf, struct blastQuery *bq)
 /* Read in next gapped alignment.   Does *not* put it on bf->gapped list. 
  * Return NULL at EOF or end of query. */
 {
 char *words[16];
 int wordCount;
 struct blastGappedAli *bga;
 struct blastBlock *bb;
 int lenSearch;
 
 verbose(TRACE_LEVEL, "blastFileNextGapped\n");
 
 char *line = findNextGapped(bf, bq);
 if (line == NULL)
     return NULL;
 
 AllocVar(bga);
 bga->query = bq;
 bga->targetName = cloneString(line+1); 
 bga->psiRound = bq->psiRounds;
 
 /* Process something like:
  *      Length = 100000
  * however this follows a possible multi-line description, so be specified
  * and limit how far we can scan
  */
 for (lenSearch=0; lenSearch<25; lenSearch++)
 	{
 	line = bfNeedNextLine(bf);
         if (isRoundLine(line))
             parseRoundLine(line, bq);
 	wordCount = chopLine(line, words);
 	if (wordCount == 3 && sameString(words[0], "Length") &&  sameString(words[1], "=")
             && isdigit(words[2][0]))
 		break;
 	}
 if (lenSearch>=25)
     bfError(bf, "Expecting Length =");
 decomma(words[2]);
 bga->targetSize = atoi(words[2]);
 
 /* Get all the blocks. */
 while ((bb = blastFileNextBlock(bf, bq, bga)) != NULL)
     {
     slAddHead(&bga->blocks, bb);
     }
 slReverse(&bga->blocks);
 return bga;
 }
 
 static int getStrand(struct blastFile *bf, char *strand)
 /* Translate "Plus" or "Minus" to +1 or -1. */
 {
 if (sameWord("Plus", strand))
     return 1;
 else if (sameWord("Minus", strand))
     return -1;
 else
     {
     bfError(bf, "Expecting Plus or Minus after Strand");
     return 0;
     }
 }
 
 static boolean nextBlockLine(struct blastFile *bf, struct blastQuery *bq, char **retLine)
 /* Get next block line.  Return FALSE and reuse line if it's
  * an end of block type line. */
 {
 struct lineFile *lf = bf->lf;
 char *line;
 
 *retLine = line = bfNextLine(bf);
 if (line == NULL)
     return FALSE;
 if (isRoundLine(line))
     parseRoundLine(line, bq);
 
 /*
 the last condition was added to deal with the new blast output format and is meant to find lines such as this one:
 TBLASTN 2.2.15 [Oct-15-2006]
 I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc
 */
 if (line[0] == '>' || startsWith("Query=", line) || startsWith("  Database:", line) || (stringIn("BLAST", line) != NULL))
     {
     lineFileReuse(lf);
     return FALSE;
     }
 return TRUE;
 }
 
 static double evalToDouble(char *s)
 /* Convert string from e-val to floating point rep.
  * e-val is basically ascii floating point, but
  * small ones may be 'e-100' instead of 1.0e-100
  */
 {
 if (isdigit(s[0]))
     return atof(s);
 else
     {
     char buf[64];
     safef(buf, sizeof(buf), "1.0%s", s);
     return atof(buf);
     }
 }
 
 static boolean parseBlockLine(struct blastFile *bf, int *startRet, int *endRet,
                            struct dyString *seq)
 /* read and parse the next target or query line, like:
  *   Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488
  *
  * also handle broken NCBI tblastn output like:
  *   Sbjct: 1181YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ 1360
  *
  * Ignores and returns FALSE on bogus records generated by PSI BLAST, such as
  *   Query: 0   --------------------------                                  
  *   Sbjct: 38  PPGPPGVAGGNQTTVVVIYGPPGPPG                                   63
  *   Query: 0                                                               
  *   Sbjct: 63                                                               63
  * If FALSE is returned, the output parameters will be unchanged.
  */
 {
 char* line = bfNeedNextLine(bf);
 int a, b, s, e;
 char *words[16];
 int wordCount = chopLine(line, words);
 if ((wordCount < 2) || (wordCount > 4) || !(sameString("Query:", words[0]) || sameString("Sbjct:", words[0])))
     bfSyntax(bf);
 
 /* look for one of the bad formats to ignore, as described above */
 if (((wordCount == 2) && isAllDigits(words[1]))
     || ((wordCount == 3) && isAllDigits(words[1]) && isAllDigits(words[2]))
     || ((wordCount == 3) && isAllDigits(words[1]) && isAllDashes(words[2])))
     {
     bfWarn(bf, "Ignored invalid alignment format for aligned sequence pair");
     return FALSE;
     }
 
 /* special handling for broken output with no space between start and
  * sequence */
 if (wordCount == 3)
     {
     char *p;
     if (!isdigit(words[1][0]) || !isdigit(words[2][0]))
         bfSyntax(bf);
     a = atoi(words[1]);
     b = atoi(words[2]);
     p = words[1];
     while ((*p != '\0') && (isdigit(*p)))
         p++;
     dyStringAppend(seq, p);
     }
 else
     {
     if (!isdigit(words[1][0]) || !isdigit(words[3][0]))
         bfSyntax(bf);
     a = atoi(words[1]);
     b = atoi(words[3]);
     dyStringAppend(seq, words[2]);
     }
 s = min(a,b);
 e = max(a,b);
 *startRet = min(s, *startRet);
 *endRet = max(e, *endRet);
 return TRUE;
 }
 
 static boolean findBlockSeqPair(struct blastFile *bf, struct blastQuery *bq)
 /* scan forward for the next pair of Query:/Sbjct: sequences */
 {
 char *line;
 for (;;)
     {
     if (!nextBlockLine(bf, bq, &line))
         return FALSE;
     if (startsWith(" Score", line))
         {
         lineFileReuse(bf->lf);
         return FALSE;
         }
     if (startsWith("Query:", line))
         {
         lineFileReuse(bf->lf);
         return TRUE;
         }
     }
 }
 
 static void clearBlastBlock(struct blastBlock *bb, struct dyString *qString, struct dyString *tString)
 /* reset the contents of a blast block being accummulated */
 {
 bb->qStart = bb->tStart = 0x3fffffff;
 bb->qEnd = bb->tEnd = -bb->qStart;
 dyStringClear(qString);
 dyStringClear(tString);
 }
 
 static void parseBlockSeqPair(struct blastFile *bf, struct blastBlock *bb,
                               struct dyString *qString, struct dyString *tString)
 /* parse the current pair Query:/Sbjct: sequences */
 {
 boolean isOk = TRUE;
 
 /* Query line */
 if (!parseBlockLine(bf, &bb->qStart, &bb->qEnd, qString))
     isOk = FALSE;
 
 /* Skip next line. */
 bfNeedNextLine(bf);
 
 /* Fetch target sequence line. */
 if (!parseBlockLine(bf, &bb->tStart, &bb->tEnd, tString))
     isOk = FALSE;
 if (!isOk)
     {
     // reset accumulated data so we discard everything before bogus pair
     clearBlastBlock(bb, qString, tString);
     }
 }
 
 
 static struct blastBlock *nextBlock(struct blastFile *bf, struct blastQuery *bq,
                                     struct blastGappedAli *bga, boolean *skipRet)
 /* Read in next blast block.  Return NULL at EOF or end of gapped
  * alignment. If an unparsable block is found, set skipRet to TRUE and return
  * NULL. */
 {
 struct blastBlock *bb;
 char *line;
 char *words[16];
 int wordCount;
 char *parts[3];
 int partCount;
 static struct dyString *qString = NULL, *tString = NULL;
 
 verbose(TRACE_LEVEL,  "blastFileNextBlock\n");
 *skipRet = FALSE;
 
 /* Seek until get something like:
  *   Score = 8770 bits (4424), Expect = 0.0
  * or something that looks like we're done with this gapped
  * alignment. */
 for (;;)
     {
     if (!nextBlockLine(bf, bq, &line))
 	return NULL;
     if (startsWith(" Score", line))
 	break;
     }
 AllocVar(bb);
 bb->gappedAli = bga;
 wordCount = chopLine(line, words);
 if (wordCount < 8 || !sameWord("Score", words[0]) 
     || !isdigit(words[2][0]) || !(isdigit(words[7][0]) || words[7][0] == 'e')
     || !startsWith("Expect", words[5]))
     {
     bfError(bf, "Expecting something like:\n"
              "Score = 8770 bits (4424), Expect = 0.0");
     }
 bb->bitScore = atof(words[2]);
 bb->eVal = evalToDouble(words[7]);
 
 /* Process something like:
  *   Identities = 8320/9618 (86%), Gaps = 3/9618 (0%)
  *             or
  *   Identities = 8320/9618 (86%)
  *             or
  *   Identities = 10/19 (52%), Positives = 15/19 (78%), Frame = +2
  *     (wu-tblastn)
  *             or
  *   Identities = 256/400 (64%), Positives = 306/400 (76%)
  *   Frame = +1 / -2
  *     (tblastn)
  *
  *   Identities = 1317/10108 (13%), Positives = 2779/10108 (27%), Gaps = 1040/10108
  *   (10%)
  *      - wrap on long lines
  *
  * Handle weird cases where the is only a `Score' line, with no `Identities'
  * lines by skipping the alignment; they seem line small, junky alignments.
  */
 line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if (wordCount < 3 || !sameWord("Identities", words[0]))
     {
     if (wordCount > 1 || sameWord("Score", words[0]))
         {
         /* ugly hack to skip block with no identities */
         *skipRet = TRUE;
         blastBlockFree(&bb);
         return NULL;
         }
     bfError(bf, "Expecting identity count");
     }
 partCount = chopByChar(words[2], '/', parts, ArraySize(parts));
 if (partCount != 2 || !isdigit(parts[0][0]) || !isdigit(parts[1][0]))
     bfSyntax(bf);
 bb->matchCount = atoi(parts[0]);
 bb->totalCount = atoi(parts[1]);
 if (wordCount >= 7 && sameWord("Gaps", words[4]))
     {
     if (!isdigit(words[6][0]))
 	bfSyntax(bf);
     bb->insertCount = atoi(words[6]);
     }
 if ((wordCount >= 11) && sameWord("Frame", words[8]))
     {
     bb->qStrand = '+';
     bb->tStrand = words[10][0];
     bb->tFrame = atoi(words[10]);
     }
 
 line = bfNeedNextLine(bf);
 boolean wrapped = (startsWith("(", line));
 
 /* Process something like:
  *     Strand = Plus / Plus (blastn)
  *     Frame = +1           (tblastn)
  *     Frame = +1 / -2      (tblastx)
  *     <blank line>         (blastp)
  * note that wu-tblastn puts frame on Identities line
  */
 if (wrapped)
     line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if ((wordCount >= 5) && sameWord("Strand", words[0]))
     {
     bb->qStrand = getStrand(bf, words[2]);
     bb->tStrand = getStrand(bf, words[4]);
     }
 else if ((wordCount >= 5) && sameWord("Frame", words[0]) && (words[3][0] == '/'))
     {
     // Frame = +1 / -2      (tblastx)
     bb->qStrand = (words[2][0] == '-') ? -1 : 1;
     bb->tStrand = (words[4][0] == '-') ? -1 : 1;
     bb->qFrame = atoi(words[2]);
     bb->tFrame = atoi(words[4]);
     }
 else if ((wordCount >= 3) && sameWord("Frame", words[0]))
     {
     // Frame = +1           (tblastn)
     bb->qStrand = 1;
     bb->tStrand = (words[2][0] == '-') ? -1 : 1;
     bb->qFrame = atoi(words[2]);
     bb->tFrame = 1;
     }
 else if (wordCount == 0)
     {
     /* if we didn't parse frame, default it */
     if (bb->qStrand == 0)
         {
         bb->qStrand = '+';
         bb->tStrand = '+';
         }
     }
 else
     bfError(bf, "Expecting Strand, Frame or blank line");
 
 
 /* Process alignment lines.  They come in groups of three
  * separated by a blank line - something like:
  * Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488
  *              |||||| |||||||||| ||| ||||||||||||||||||||||| || || ||||||||
  * Sbjct: 62966 taccttaacattcctcaatgtttcatcatcgttctctcctccaaatggtgaaagtccgga 63025
  */
 if (qString == NULL)
     {
     qString = newDyString(50000);
     tString = newDyString(50000);
     }
 clearBlastBlock(bb, qString, tString);
 for (;;)
     {
     if (!findBlockSeqPair(bf, bq))
         break;
     parseBlockSeqPair(bf, bb, qString, tString);
     }
 
 /* convert to [0..n) and move to strand coords if necessary */
 bb->qStart--;
 if (bb->qStrand < 0)
     reverseIntRange(&bb->qStart, &bb->qEnd, bq->queryBaseCount);
 bb->tStart--;
 if (bb->tStrand < 0)
     reverseIntRange(&bb->tStart, &bb->tEnd, bga->targetSize);
 bb->qSym = cloneMem(qString->string, qString->stringSize+1);
 bb->tSym = cloneMem(tString->string, tString->stringSize+1);
 return bb;
 }
 
 struct blastBlock *blastFileNextBlock(struct blastFile *bf, 
 	struct blastQuery *bq, struct blastGappedAli *bga)
 /* Read in next blast block.  Return NULL at EOF or end of
  * gapped alignment. */
 {
 struct blastBlock *bb = NULL;
 boolean skip = FALSE;
 
 while (((bb = nextBlock(bf, bq, bga, &skip)) == NULL) && skip)
     continue; /* skip to next one */
 
 return bb;
 }
 
 void blastFileFree(struct blastFile **pBf)
 /* Free blast file. */
 {
 struct blastFile *bf = *pBf;
 if (bf != NULL)
     {
     lineFileClose(&bf->lf);
     freeMem(bf->fileName);
     freeMem(bf->program);
     freeMem(bf->version);
     freeMem(bf->buildDate);
     blastQueryFreeList(&bf->queries);
     freez(pBf);
     }
 }
 
 void blastFileFreeList(struct blastFile **pList)
 /* Free list of blast files. */
 {
 struct blastFile *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastFileFree(&el);
     }
 *pList = NULL;
 }
 
 void blastQueryFree(struct blastQuery **pBq)
 /* Free single blastQuery. */
 {
 struct blastQuery *bq;
 if ((bq = *pBq) != NULL)
     {
     freeMem(bq->query);
     freeMem(bq->database);
     blastGappedAliFreeList(&bq->gapped);
     freez(pBq);
     }
 }
 
 void blastQueryFreeList(struct blastQuery **pList)
 /* Free list of blastQuery's. */
 {
 struct blastQuery *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastQueryFree(&el);
     }
 *pList = NULL;
 }
 
 
 void blastGappedAliFree(struct blastGappedAli **pBga)
 /* Free blastGappedAli. */
 {
 struct blastGappedAli *bga = *pBga;
 if (bga != NULL)
     {
     freeMem(bga->targetName);
     blastBlockFreeList(&bga->blocks);
     freez(pBga);
     }
 }
 
 void blastGappedAliFreeList(struct blastGappedAli **pList)
 /* Free blastGappedAli list. */
 {
 struct blastGappedAli *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastGappedAliFree(&el);
     }
 *pList = NULL;
 }
 
 
 void blastBlockFree(struct blastBlock **pBb)
 /* Free a single blastBlock. */
 {
 struct blastBlock *bb = *pBb;
 if (bb != NULL)
     {
     freeMem(bb->qSym);
     freeMem(bb->tSym);
     freez(pBb);
     }
 }
 
 void blastBlockFreeList(struct blastBlock **pList)
 /* Free a list of blastBlocks. */
 {
 struct blastBlock *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastBlockFree(&el);
     }
 *pList = NULL;
 }
 
 void blastBlockPrint(struct blastBlock* bb, FILE* out)
 /* print a BLAST block for debugging purposes  */
 {
 fprintf(out, "    blk: %d-%d <=> %d-%d tcnt=%d mcnt=%d icnt=%d\n",
         bb->qStart, bb->qEnd,  bb->tStart, bb->tEnd,
         bb->totalCount, bb->matchCount, bb->insertCount);
 fprintf(out, "        Q: %s\n", bb->qSym);
 fprintf(out, "        T: %s\n", bb->tSym);
 }
 
 void blastGappedAliPrint(struct blastGappedAli* ba, FILE* out)
 /* print a BLAST gapped alignment for debugging purposes  */
 {
 struct blastBlock *bb;
 fprintf(out, "%s <=> %s", ba->query->query, ba->targetName);
 if (ba->psiRound > 0)
     fprintf(out, " round: %d", ba->psiRound);
 fputc('\n', out);
 for (bb = ba->blocks; bb != NULL; bb = bb->next)
     {
     blastBlockPrint(bb, out);
     }
 }
 
 void blastQueryPrint(struct blastQuery *bq, FILE* out)
 /* print a BLAST query for debugging purposes  */
 {
 struct blastGappedAli *ba;
 for (ba = bq->gapped; ba != NULL; ba = ba->next)
     blastGappedAliPrint(ba, out);
 }