1cc8c6d3d7f2357898ad366c94b1f33a403a2aee angie Thu Dec 8 14:14:33 2016 -0800 Libifying isAllDigits from a handful of places into common.c. diff --git src/lib/blastParse.c src/lib/blastParse.c index 49026d6..07bd33f 100644 --- src/lib/blastParse.c +++ src/lib/blastParse.c @@ -1,900 +1,889 @@ /* blastParse - read in blast output into C data structure. */ /* Copyright (C) 2011 The Regents of the University of California * See README in this or parent directory for licensing information. */ #include "common.h" #include "dystring.h" #include "linefile.h" #include "dnautil.h" #include "sqlNum.h" #include "blastParse.h" #include "verbose.h" #define WARN_LEVEL 1 /* verbose level to enable warnings */ #define TRACE_LEVEL 3 /* verbose level to enable tracing of files */ #define DUMP_LEVEL 4 /* verbose level to enable dumping of parsed */ struct blastFile *blastFileReadAll(char *fileName) /* Read all blast alignment in file. */ { struct blastFile *bf; struct blastQuery *bq; bf = blastFileOpenVerify(fileName); while ((bq = blastFileNextQuery(bf)) != NULL) { slAddHead(&bf->queries, bq); } slReverse(&bf->queries); lineFileClose(&bf->lf); return bf; } static void bfError(struct blastFile *bf, char *message) /* Print blast file error message. */ { errAbort("%s:%d: %s", bf->fileName, bf->lf->lineIx, message); } static void bfWarn(struct blastFile *bf, char *message) /* Print blast file warning message. */ { verbose(WARN_LEVEL, "Warning: %s:%d: %s\n", bf->fileName, bf->lf->lineIx, message); } static void bfUnexpectedEof(struct blastFile *bf) /* generate error on unexpected EOF */ { errAbort("Unexpected end of file in %s\n", bf->fileName); } static void bfSyntax(struct blastFile *bf) /* General error message. */ { bfError(bf, "Can't cope with BLAST output syntax"); } -static boolean isAllDigits(char *s) -/* test if a string is all digits */ -{ -for (; *s != '\0'; s++) - { - if (!isdigit(*s)) - return FALSE; - } -return TRUE; -} - static boolean isAllDashes(char *s) /* test if a string is all dashes */ { for (; *s != '\0'; s++) { if (*s != '-') return FALSE; } return TRUE; } static char *bfNextLine(struct blastFile *bf) /* Fetch next line of input trying, or NULL if not found */ { char *line = NULL; if (lineFileNext(bf->lf, &line, NULL)) { verbose(TRACE_LEVEL, " => %s\n", line); return line; } else { verbose(TRACE_LEVEL, " => EOF\n"); return NULL; } } static boolean bfSkipBlankLines(struct blastFile *bf) /* skip blank lines, return FALSE on EOF */ { char *line = NULL; while ((line = bfNextLine(bf)) != NULL) { if (skipLeadingSpaces(line)[0] != '\0') { lineFileReuse(bf->lf); return TRUE; } } return FALSE; /* EOF */ } static char *bfNeedNextLine(struct blastFile *bf) /* Fetch next line of input or die trying. */ { char *line = bfNextLine(bf); if (line == NULL) bfUnexpectedEof(bf); return line; } static char *bfSearchForLine(struct blastFile *bf, char *start) /* scan for a line starting with the specified string */ { for (;;) { char *line = bfNextLine(bf); if (line == NULL) return NULL; if (startsWith(start, line)) return line; } } static void bfBadHeader(struct blastFile *bf) /* Report bad header. */ { bfError(bf, "Bad first line\nShould be something like:\n" "BLASTN 2.0.11 [Jan-20-2000]"); } struct blastFile *blastFileOpenVerify(char *fileName) /* Open file, read and verify header. */ { struct blastFile *bf; char *line; char *words[16]; int wordCount; struct lineFile *lf; AllocVar(bf); bf->lf = lf = lineFileOpen(fileName, TRUE); bf->fileName = cloneString(fileName); /* Parse first line - something like: */ line = bfNeedNextLine(bf); wordCount = chopLine(line, words); if (wordCount < 3) bfBadHeader(bf); bf->program = cloneString(words[0]); bf->version = cloneString(words[1]); bf->buildDate = cloneString(words[2]); if (!wildMatch("*BLAST*", bf->program)) bfBadHeader(bf); if (!isdigit(bf->version[0])) bfBadHeader(bf); if (bf->buildDate[0] != '[') bfBadHeader(bf); return bf; } void decomma(char *s) /* Remove commas from string. */ { char *d = s; char c; for (;;) { c = *s++; if (c != ',') *d++ = c; if (c == 0) break; } } static void parseQueryLines(struct blastFile *bf, char *line, struct blastQuery *bq) /* Parse the Query= lines */ { char *s, *e; char *words[16]; int wordCount; if (bq->query != NULL) bfError(bf, "already parse Query="); /* Process something like: * Query= MM39H11 00630 */ wordCount = chopLine(line, words); if (wordCount < 2) bfError(bf, "No sequence name in query line"); bq->query = cloneString(words[1]); for (;;) { line = bfNeedNextLine(bf); s = skipLeadingSpaces(line); if (s[0] == '(') break; } if (!isdigit(s[1])) { bfError(bf, "expecting something like:\n" " (45,693 letters)"); } s += 1; if ((e = strchr(s, ' ')) == NULL) { bfError(bf, "expecting something like:\n" " (45,693 letters)"); } *e = 0; decomma(s); bq->queryBaseCount = atoi(s); } static void parseDatabaseLines(struct blastFile *bf, char *line, struct blastQuery *bq) /* Process something like: * Database: chr22.fa * 977 sequences; 95,550,797 total letters */ { static struct dyString *tmpBuf = NULL; char *words[16]; int wordCount; if (bq->database != NULL) bfError(bf, "already parse Database:"); if (tmpBuf == NULL) tmpBuf = dyStringNew(512); /* parse something like * Database: celegans98 * some versions of blastp include the absolute path, but * then split it across lines. */ wordCount = chopLine(line, words); if (wordCount < 2) bfError(bf, "Expecting database name"); dyStringClear(tmpBuf); dyStringAppend(tmpBuf, words[1]); while (line = bfNeedNextLine(bf), !isspace(line[0])) { dyStringAppend(tmpBuf, line); } bq->database = cloneString(tmpBuf->string); /* Process something like: * 977 sequences; 95,550,797 total letters */ wordCount = chopLine(line, words); if (wordCount < 3 || !isdigit(words[0][0]) || !isdigit(words[2][0])) bfError(bf, "Expecting database info"); decomma(words[0]); decomma(words[2]); bq->dbSeqCount = atoi(words[0]); bq->dbBaseCount = atoi(words[2]); } static char *roundLinePrefix = "Results from round "; // start of a round line static boolean isRoundLine(char *line) /* check if a line is a PSI round number line */ { return startsWith(roundLinePrefix, line); } static void parseRoundLine(char *line, struct blastQuery *bq) /* round line and save current round in query * Results from round 1 */ { char *p = skipLeadingSpaces(line + strlen(roundLinePrefix)); bq->psiRounds = atoi(p); } struct blastQuery *blastFileNextQuery(struct blastFile *bf) /* Read all alignments associated with next query. Return NULL at EOF. */ { char *line; struct blastQuery *bq; struct blastGappedAli *bga; AllocVar(bq); verbose(TRACE_LEVEL, "blastFileNextQuery\n"); /* find and parse Query= */ line = bfSearchForLine(bf, "Query="); if (line == NULL) return NULL; parseQueryLines(bf, line, bq); /* find and parse Database: */ line = bfSearchForLine(bf, "Database:"); if (line == NULL) bfUnexpectedEof(bf); parseDatabaseLines(bf, line, bq); /* Seek to beginning of first gapped alignment. */ for (;;) { line = bfNeedNextLine(bf); if (line[0] == '>') { lineFileReuse(bf->lf); break; } else if (isRoundLine(line)) parseRoundLine(line, bq); else if (stringIn("No hits found", line) != NULL) break; } /* Read in gapped alignments. */ while ((bga = blastFileNextGapped(bf, bq)) != NULL) { slAddHead(&bq->gapped, bga); } slReverse(&bq->gapped); if (verboseLevel() >= DUMP_LEVEL) { verbose(DUMP_LEVEL, "blastFileNextQuery result:\n"); blastQueryPrint(bq, stderr); } return bq; } static char *findNextGapped(struct blastFile *bf, struct blastQuery *bq) /* scan for next gapped alignment, return line or NULL if not hit */ { while (TRUE) { if (!bfSkipBlankLines(bf)) return NULL; char *line = bfNextLine(bf); /* * the last condition was added to deal with the new blast output format and is meant to find lines such as this one: * TBLASTN 2.2.15 [Oct-15-2006] * I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc */ if (startsWith(" Database:", line) || (stringIn("BLAST", line) != NULL)) { lineFileReuse(bf->lf); return NULL; } if (line[0] == '>') return line; if (isRoundLine(line)) parseRoundLine(line, bq); } } struct blastGappedAli *blastFileNextGapped(struct blastFile *bf, struct blastQuery *bq) /* Read in next gapped alignment. Does *not* put it on bf->gapped list. * Return NULL at EOF or end of query. */ { char *words[16]; int wordCount; struct blastGappedAli *bga; struct blastBlock *bb; int lenSearch; verbose(TRACE_LEVEL, "blastFileNextGapped\n"); char *line = findNextGapped(bf, bq); if (line == NULL) return NULL; AllocVar(bga); bga->query = bq; bga->targetName = cloneString(line+1); bga->psiRound = bq->psiRounds; /* Process something like: * Length = 100000 * however this follows a possible multi-line description, so be specified * and limit how far we can scan */ for (lenSearch=0; lenSearch<25; lenSearch++) { line = bfNeedNextLine(bf); if (isRoundLine(line)) parseRoundLine(line, bq); wordCount = chopLine(line, words); if (wordCount == 3 && sameString(words[0], "Length") && sameString(words[1], "=") && isdigit(words[2][0])) break; } if (lenSearch>=25) bfError(bf, "Expecting Length ="); decomma(words[2]); bga->targetSize = atoi(words[2]); /* Get all the blocks. */ while ((bb = blastFileNextBlock(bf, bq, bga)) != NULL) { slAddHead(&bga->blocks, bb); } slReverse(&bga->blocks); return bga; } static int getStrand(struct blastFile *bf, char *strand) /* Translate "Plus" or "Minus" to +1 or -1. */ { if (sameWord("Plus", strand)) return 1; else if (sameWord("Minus", strand)) return -1; else { bfError(bf, "Expecting Plus or Minus after Strand"); return 0; } } static boolean nextBlockLine(struct blastFile *bf, struct blastQuery *bq, char **retLine) /* Get next block line. Return FALSE and reuse line if it's * an end of block type line. */ { struct lineFile *lf = bf->lf; char *line; *retLine = line = bfNextLine(bf); if (line == NULL) return FALSE; if (isRoundLine(line)) parseRoundLine(line, bq); /* the last condition was added to deal with the new blast output format and is meant to find lines such as this one: TBLASTN 2.2.15 [Oct-15-2006] I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc */ if (line[0] == '>' || startsWith("Query=", line) || startsWith(" Database:", line) || (stringIn("BLAST", line) != NULL)) { lineFileReuse(lf); return FALSE; } return TRUE; } static double evalToDouble(char *s) /* Convert string from e-val to floating point rep. * e-val is basically ascii floating point, but * small ones may be 'e-100' instead of 1.0e-100 */ { if (isdigit(s[0])) return atof(s); else { char buf[64]; safef(buf, sizeof(buf), "1.0%s", s); return atof(buf); } } static boolean parseBlockLine(struct blastFile *bf, int *startRet, int *endRet, struct dyString *seq) /* read and parse the next target or query line, like: * Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488 * * also handle broken NCBI tblastn output like: * Sbjct: 1181YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ 1360 * * Ignores and returns FALSE on bogus records generated by PSI BLAST, such as * Query: 0 -------------------------- * Sbjct: 38 PPGPPGVAGGNQTTVVVIYGPPGPPG 63 * Query: 0 * Sbjct: 63 63 * If FALSE is returned, the output parameters will be unchanged. */ { char* line = bfNeedNextLine(bf); int a, b, s, e; char *words[16]; int wordCount = chopLine(line, words); if ((wordCount < 2) || (wordCount > 4) || !(sameString("Query:", words[0]) || sameString("Sbjct:", words[0]))) bfSyntax(bf); /* look for one of the bad formats to ignore, as described above */ if (((wordCount == 2) && isAllDigits(words[1])) || ((wordCount == 3) && isAllDigits(words[1]) && isAllDigits(words[2])) || ((wordCount == 3) && isAllDigits(words[1]) && isAllDashes(words[2]))) { bfWarn(bf, "Ignored invalid alignment format for aligned sequence pair"); return FALSE; } /* special handling for broken output with no space between start and * sequence */ if (wordCount == 3) { char *p; if (!isdigit(words[1][0]) || !isdigit(words[2][0])) bfSyntax(bf); a = atoi(words[1]); b = atoi(words[2]); p = words[1]; while ((*p != '\0') && (isdigit(*p))) p++; dyStringAppend(seq, p); } else { if (!isdigit(words[1][0]) || !isdigit(words[3][0])) bfSyntax(bf); a = atoi(words[1]); b = atoi(words[3]); dyStringAppend(seq, words[2]); } s = min(a,b); e = max(a,b); *startRet = min(s, *startRet); *endRet = max(e, *endRet); return TRUE; } static boolean findBlockSeqPair(struct blastFile *bf, struct blastQuery *bq) /* scan forward for the next pair of Query:/Sbjct: sequences */ { char *line; for (;;) { if (!nextBlockLine(bf, bq, &line)) return FALSE; if (startsWith(" Score", line)) { lineFileReuse(bf->lf); return FALSE; } if (startsWith("Query:", line)) { lineFileReuse(bf->lf); return TRUE; } } } static void clearBlastBlock(struct blastBlock *bb, struct dyString *qString, struct dyString *tString) /* reset the contents of a blast block being accummulated */ { bb->qStart = bb->tStart = 0x3fffffff; bb->qEnd = bb->tEnd = -bb->qStart; dyStringClear(qString); dyStringClear(tString); } static void parseBlockSeqPair(struct blastFile *bf, struct blastBlock *bb, struct dyString *qString, struct dyString *tString) /* parse the current pair Query:/Sbjct: sequences */ { boolean isOk = TRUE; /* Query line */ if (!parseBlockLine(bf, &bb->qStart, &bb->qEnd, qString)) isOk = FALSE; /* Skip next line. */ bfNeedNextLine(bf); /* Fetch target sequence line. */ if (!parseBlockLine(bf, &bb->tStart, &bb->tEnd, tString)) isOk = FALSE; if (!isOk) { // reset accumulated data so we discard everything before bogus pair clearBlastBlock(bb, qString, tString); } } static struct blastBlock *nextBlock(struct blastFile *bf, struct blastQuery *bq, struct blastGappedAli *bga, boolean *skipRet) /* Read in next blast block. Return NULL at EOF or end of gapped * alignment. If an unparsable block is found, set skipRet to TRUE and return * NULL. */ { struct blastBlock *bb; char *line; char *words[16]; int wordCount; char *parts[3]; int partCount; static struct dyString *qString = NULL, *tString = NULL; verbose(TRACE_LEVEL, "blastFileNextBlock\n"); *skipRet = FALSE; /* Seek until get something like: * Score = 8770 bits (4424), Expect = 0.0 * or something that looks like we're done with this gapped * alignment. */ for (;;) { if (!nextBlockLine(bf, bq, &line)) return NULL; if (startsWith(" Score", line)) break; } AllocVar(bb); bb->gappedAli = bga; wordCount = chopLine(line, words); if (wordCount < 8 || !sameWord("Score", words[0]) || !isdigit(words[2][0]) || !(isdigit(words[7][0]) || words[7][0] == 'e') || !startsWith("Expect", words[5])) { bfError(bf, "Expecting something like:\n" "Score = 8770 bits (4424), Expect = 0.0"); } bb->bitScore = atof(words[2]); bb->eVal = evalToDouble(words[7]); /* Process something like: * Identities = 8320/9618 (86%), Gaps = 3/9618 (0%) * or * Identities = 8320/9618 (86%) * or * Identities = 10/19 (52%), Positives = 15/19 (78%), Frame = +2 * (wu-tblastn) * or * Identities = 256/400 (64%), Positives = 306/400 (76%) * Frame = +1 / -2 * (tblastn) * * Identities = 1317/10108 (13%), Positives = 2779/10108 (27%), Gaps = 1040/10108 * (10%) * - wrap on long lines * * Handle weird cases where the is only a `Score' line, with no `Identities' * lines by skipping the alignment; they seem line small, junky alignments. */ line = bfNeedNextLine(bf); wordCount = chopLine(line, words); if (wordCount < 3 || !sameWord("Identities", words[0])) { if (wordCount > 1 || sameWord("Score", words[0])) { /* ugly hack to skip block with no identities */ *skipRet = TRUE; blastBlockFree(&bb); return NULL; } bfError(bf, "Expecting identity count"); } partCount = chopByChar(words[2], '/', parts, ArraySize(parts)); if (partCount != 2 || !isdigit(parts[0][0]) || !isdigit(parts[1][0])) bfSyntax(bf); bb->matchCount = atoi(parts[0]); bb->totalCount = atoi(parts[1]); if (wordCount >= 7 && sameWord("Gaps", words[4])) { if (!isdigit(words[6][0])) bfSyntax(bf); bb->insertCount = atoi(words[6]); } if ((wordCount >= 11) && sameWord("Frame", words[8])) { bb->qStrand = '+'; bb->tStrand = words[10][0]; bb->tFrame = atoi(words[10]); } line = bfNeedNextLine(bf); boolean wrapped = (startsWith("(", line)); /* Process something like: * Strand = Plus / Plus (blastn) * Frame = +1 (tblastn) * Frame = +1 / -2 (tblastx) * (blastp) * note that wu-tblastn puts frame on Identities line */ if (wrapped) line = bfNeedNextLine(bf); wordCount = chopLine(line, words); if ((wordCount >= 5) && sameWord("Strand", words[0])) { bb->qStrand = getStrand(bf, words[2]); bb->tStrand = getStrand(bf, words[4]); } else if ((wordCount >= 5) && sameWord("Frame", words[0]) && (words[3][0] == '/')) { // Frame = +1 / -2 (tblastx) bb->qStrand = (words[2][0] == '-') ? -1 : 1; bb->tStrand = (words[4][0] == '-') ? -1 : 1; bb->qFrame = atoi(words[2]); bb->tFrame = atoi(words[4]); } else if ((wordCount >= 3) && sameWord("Frame", words[0])) { // Frame = +1 (tblastn) bb->qStrand = 1; bb->tStrand = (words[2][0] == '-') ? -1 : 1; bb->qFrame = atoi(words[2]); bb->tFrame = 1; } else if (wordCount == 0) { /* if we didn't parse frame, default it */ if (bb->qStrand == 0) { bb->qStrand = '+'; bb->tStrand = '+'; } } else bfError(bf, "Expecting Strand, Frame or blank line"); /* Process alignment lines. They come in groups of three * separated by a blank line - something like: * Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488 * |||||| |||||||||| ||| ||||||||||||||||||||||| || || |||||||| * Sbjct: 62966 taccttaacattcctcaatgtttcatcatcgttctctcctccaaatggtgaaagtccgga 63025 */ if (qString == NULL) { qString = newDyString(50000); tString = newDyString(50000); } clearBlastBlock(bb, qString, tString); for (;;) { if (!findBlockSeqPair(bf, bq)) break; parseBlockSeqPair(bf, bb, qString, tString); } /* convert to [0..n) and move to strand coords if necessary */ bb->qStart--; if (bb->qStrand < 0) reverseIntRange(&bb->qStart, &bb->qEnd, bq->queryBaseCount); bb->tStart--; if (bb->tStrand < 0) reverseIntRange(&bb->tStart, &bb->tEnd, bga->targetSize); bb->qSym = cloneMem(qString->string, qString->stringSize+1); bb->tSym = cloneMem(tString->string, tString->stringSize+1); return bb; } struct blastBlock *blastFileNextBlock(struct blastFile *bf, struct blastQuery *bq, struct blastGappedAli *bga) /* Read in next blast block. Return NULL at EOF or end of * gapped alignment. */ { struct blastBlock *bb = NULL; boolean skip = FALSE; while (((bb = nextBlock(bf, bq, bga, &skip)) == NULL) && skip) continue; /* skip to next one */ return bb; } void blastFileFree(struct blastFile **pBf) /* Free blast file. */ { struct blastFile *bf = *pBf; if (bf != NULL) { lineFileClose(&bf->lf); freeMem(bf->fileName); freeMem(bf->program); freeMem(bf->version); freeMem(bf->buildDate); blastQueryFreeList(&bf->queries); freez(pBf); } } void blastFileFreeList(struct blastFile **pList) /* Free list of blast files. */ { struct blastFile *el, *next; for (el = *pList; el != NULL; el = next) { next = el->next; blastFileFree(&el); } *pList = NULL; } void blastQueryFree(struct blastQuery **pBq) /* Free single blastQuery. */ { struct blastQuery *bq; if ((bq = *pBq) != NULL) { freeMem(bq->query); freeMem(bq->database); blastGappedAliFreeList(&bq->gapped); freez(pBq); } } void blastQueryFreeList(struct blastQuery **pList) /* Free list of blastQuery's. */ { struct blastQuery *el, *next; for (el = *pList; el != NULL; el = next) { next = el->next; blastQueryFree(&el); } *pList = NULL; } void blastGappedAliFree(struct blastGappedAli **pBga) /* Free blastGappedAli. */ { struct blastGappedAli *bga = *pBga; if (bga != NULL) { freeMem(bga->targetName); blastBlockFreeList(&bga->blocks); freez(pBga); } } void blastGappedAliFreeList(struct blastGappedAli **pList) /* Free blastGappedAli list. */ { struct blastGappedAli *el, *next; for (el = *pList; el != NULL; el = next) { next = el->next; blastGappedAliFree(&el); } *pList = NULL; } void blastBlockFree(struct blastBlock **pBb) /* Free a single blastBlock. */ { struct blastBlock *bb = *pBb; if (bb != NULL) { freeMem(bb->qSym); freeMem(bb->tSym); freez(pBb); } } void blastBlockFreeList(struct blastBlock **pList) /* Free a list of blastBlocks. */ { struct blastBlock *el, *next; for (el = *pList; el != NULL; el = next) { next = el->next; blastBlockFree(&el); } *pList = NULL; } void blastBlockPrint(struct blastBlock* bb, FILE* out) /* print a BLAST block for debugging purposes */ { fprintf(out, " blk: %d-%d <=> %d-%d tcnt=%d mcnt=%d icnt=%d\n", bb->qStart, bb->qEnd, bb->tStart, bb->tEnd, bb->totalCount, bb->matchCount, bb->insertCount); fprintf(out, " Q: %s\n", bb->qSym); fprintf(out, " T: %s\n", bb->tSym); } void blastGappedAliPrint(struct blastGappedAli* ba, FILE* out) /* print a BLAST gapped alignment for debugging purposes */ { struct blastBlock *bb; fprintf(out, "%s <=> %s", ba->query->query, ba->targetName); if (ba->psiRound > 0) fprintf(out, " round: %d", ba->psiRound); fputc('\n', out); for (bb = ba->blocks; bb != NULL; bb = bb->next) { blastBlockPrint(bb, out); } } void blastQueryPrint(struct blastQuery *bq, FILE* out) /* print a BLAST query for debugging purposes */ { struct blastGappedAli *ba; for (ba = bq->gapped; ba != NULL; ba = ba->next) blastGappedAliPrint(ba, out); }