44ccfacbe3a3d4b300f80d48651c77837a4b571e
galt
  Tue Apr 26 11:12:02 2022 -0700
SQL INJECTION Prevention Version 2 - this improves our methods by making subclauses of SQL that get passed around be both easy and correct to use. The way that was achieved was by getting rid of the obscure and not well used functions sqlSafefFrag and sqlDyStringPrintfFrag and replacing them with the plain versions of those functions, since these are not needed anymore. The new version checks for NOSQLINJ in unquoted %-s which is used to include SQL clauses, and will give an error the NOSQLINJ clause is not present, and this will automatically require the correct behavior by developers. sqlDyStringPrint is a very useful function, however because it was not enforced, users could use various other dyString functions and they operated without any awareness or checking for SQL correct use. Now those dyString functions are prohibited and it will produce an error if you try to use a dyString function on a SQL string, which is simply detected by the presence of the NOSQLINJ prefix.

diff --git src/lib/blastParse.c src/lib/blastParse.c
index d59a0608..6dfa7ae 100644
--- src/lib/blastParse.c
+++ src/lib/blastParse.c
@@ -1,889 +1,889 @@
 /* blastParse - read in blast output into C data structure. */
 
 /* Copyright (C) 2011 The Regents of the University of California 
  * See kent/LICENSE or http://genome.ucsc.edu/license/ for licensing information. */
 
 #include "common.h"
 #include "dystring.h"
 #include "linefile.h"
 #include "dnautil.h"
 #include "sqlNum.h"
 #include "blastParse.h"
 #include "verbose.h"
 
 
 #define WARN_LEVEL 1   /* verbose level to enable warnings */
 #define TRACE_LEVEL 3  /* verbose level to enable tracing of files */
 #define DUMP_LEVEL 4   /* verbose level to enable dumping of parsed */
 
 struct blastFile *blastFileReadAll(char *fileName)
 /* Read all blast alignment in file. */
 {
 struct blastFile *bf;
 struct blastQuery *bq;
 
 bf = blastFileOpenVerify(fileName);
 while ((bq = blastFileNextQuery(bf)) != NULL)
     {
     slAddHead(&bf->queries, bq);
     }
 slReverse(&bf->queries);
 lineFileClose(&bf->lf);
 return bf;
 }
 
 static void bfError(struct blastFile *bf, char *message)
 /* Print blast file error message. */
 {
 errAbort("%s:%d: %s", bf->fileName, bf->lf->lineIx, message);
 }
 
 static void bfWarn(struct blastFile *bf, char *message)
 /* Print blast file warning message. */
 {
 verbose(WARN_LEVEL, "Warning: %s:%d: %s\n", bf->fileName, bf->lf->lineIx, message);
 }
 
 static void bfUnexpectedEof(struct blastFile *bf)
 /* generate error on unexpected EOF */
 {
 errAbort("Unexpected end of file in %s\n", bf->fileName);
 }
 
 static void bfSyntax(struct blastFile *bf)
 /* General error message. */
 {
 bfError(bf, "Can't cope with BLAST output syntax");
 }
 
 static boolean isAllDashes(char *s)
 /* test if a string is all dashes */
 {
 for (; *s != '\0'; s++)
     {
     if (*s != '-')
         return FALSE;
     }
 return TRUE;
 }
 
 static char *bfNextLine(struct blastFile *bf)
 /* Fetch next line of input trying, or NULL if not found */
 {
 char *line = NULL;
 if (lineFileNext(bf->lf, &line, NULL))
     {
     verbose(TRACE_LEVEL, "    => %s\n", line);
     return line;
     }
 else
     {
     verbose(TRACE_LEVEL, "    => EOF\n");
     return NULL;
     }
 }
 
 static boolean bfSkipBlankLines(struct blastFile *bf)
 /* skip blank lines, return FALSE on EOF */
 {
 char *line = NULL;
 while ((line = bfNextLine(bf)) != NULL)
     {
     if (skipLeadingSpaces(line)[0] != '\0')
         {
 	lineFileReuse(bf->lf);
         return TRUE;
         }
     }
 return FALSE; /* EOF */
 }
 
 static char *bfNeedNextLine(struct blastFile *bf)
 /* Fetch next line of input or die trying. */
 {
 char *line = bfNextLine(bf);
 if (line == NULL)
     bfUnexpectedEof(bf);
 return line;
 }
 
 static char *bfSearchForLine(struct blastFile *bf, char *start)
 /* scan for a line starting with the specified string */
 {
 for (;;)
     {
     char *line = bfNextLine(bf);
     if (line == NULL)
 	return NULL;
     if (startsWith(start, line))
         return line;
     }
 }
 
 static void bfBadHeader(struct blastFile *bf)
 /* Report bad header. */
 {
 bfError(bf, "Bad first line\nShould be something like:\n"
             "BLASTN 2.0.11 [Jan-20-2000]");
 }
 
 struct blastFile *blastFileOpenVerify(char *fileName)
 /* Open file, read and verify header. */
 {
 struct blastFile *bf;
 char *line;
 char *words[16];
 int wordCount;
 struct lineFile *lf;
 
 AllocVar(bf);
 bf->lf = lf = lineFileOpen(fileName, TRUE);
 bf->fileName = cloneString(fileName);
 
 /* Parse first line - something like: */
 line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if (wordCount < 3)
     bfBadHeader(bf);
 bf->program = cloneString(words[0]);
 bf->version = cloneString(words[1]);
 bf->buildDate = cloneString(words[2]);
 if (!wildMatch("*BLAST*", bf->program))
     bfBadHeader(bf);
 if (!isdigit(bf->version[0]))
     bfBadHeader(bf);
 if (bf->buildDate[0] != '[')
     bfBadHeader(bf);
 return bf;
 }
 
 void decomma(char *s)
 /* Remove commas from string. */
 {
 char *d = s;
 char c;
 
 for (;;)
     {
     c = *s++;
     if (c != ',')
 	*d++ = c;
     if (c == 0)
 	break;
     }
 }
 
 static void parseQueryLines(struct blastFile *bf, char *line, struct blastQuery *bq)
 /* Parse the Query= lines */
 {
 char *s, *e;
 char *words[16];
 int wordCount;
 if (bq->query != NULL)
     bfError(bf, "already parse Query=");
 
 /* Process something like:
  *    Query= MM39H11    00630     
  */
 wordCount = chopLine(line, words);
 if (wordCount < 2)
     bfError(bf, "No sequence name in query line");
 bq->query = cloneString(words[1]);
 
 for (;;)
     {
     line = bfNeedNextLine(bf);
     s = skipLeadingSpaces(line);
     if (s[0] == '(')
         break;
     }
 if (!isdigit(s[1]))
     {
     bfError(bf, "expecting something like:\n"
                 "   (45,693 letters)");
     }
 s += 1;
 if ((e = strchr(s, ' ')) == NULL)
     {
     bfError(bf, "expecting something like:\n"
                 "   (45,693 letters)");
     }
 *e = 0;
 decomma(s);
 bq->queryBaseCount = atoi(s);
 }
 
 static void parseDatabaseLines(struct blastFile *bf, char *line, struct blastQuery *bq)
 /* Process something like:
  * Database: chr22.fa 
  *        977 sequences; 95,550,797 total letters
  */
 {
 static struct dyString *tmpBuf = NULL;
 char *words[16];
 int wordCount;
 if (bq->database != NULL)
     bfError(bf, "already parse Database:");
 
 if (tmpBuf == NULL)
     tmpBuf = dyStringNew(512);
 
 /* parse something like
  * Database: celegans98
  * some versions of blastp include the absolute path, but
  * then split it across lines.
  */
 wordCount = chopLine(line, words);
 if (wordCount < 2)
     bfError(bf, "Expecting database name");
 dyStringClear(tmpBuf);
 dyStringAppend(tmpBuf, words[1]);
 while (line = bfNeedNextLine(bf), !isspace(line[0]))
     {
     dyStringAppend(tmpBuf, line);
     }
 bq->database = cloneString(tmpBuf->string);
 
 /* Process something like:
  *        977 sequences; 95,550,797 total letters
  */
 wordCount = chopLine(line, words);
 if (wordCount < 3 || !isdigit(words[0][0]) || !isdigit(words[2][0]))
     bfError(bf, "Expecting database info");
 decomma(words[0]);
 decomma(words[2]);
 bq->dbSeqCount = atoi(words[0]);
 bq->dbBaseCount = atoi(words[2]);
 }
 
 static char *roundLinePrefix = "Results from round "; // start of a round line
 
 static boolean isRoundLine(char *line)
 /* check if a line is a PSI round number line */
 {
 return startsWith(roundLinePrefix, line);
 }
 
 static void parseRoundLine(char *line, struct blastQuery *bq)
 /* round line and save current round in query
  *   Results from round 1
  */
 {
 char *p = skipLeadingSpaces(line + strlen(roundLinePrefix));
 bq->psiRounds = atoi(p);
 }
 
 struct blastQuery *blastFileNextQuery(struct blastFile *bf)
 /* Read all alignments associated with next query.  Return NULL at EOF. */
 {
 char *line;
 struct blastQuery *bq;
 struct blastGappedAli *bga;
 AllocVar(bq);
 
 verbose(TRACE_LEVEL, "blastFileNextQuery\n");
 
 /* find and parse Query= */
 line = bfSearchForLine(bf, "Query=");
 if (line == NULL)
     return NULL;
 parseQueryLines(bf, line, bq);
 
 /* find and parse Database: */
 line = bfSearchForLine(bf, "Database:");
 if (line == NULL)
     bfUnexpectedEof(bf);
 parseDatabaseLines(bf, line, bq);
 
 /* Seek to beginning of first gapped alignment. */
 for (;;)
     {
     line = bfNeedNextLine(bf);
     if (line[0] == '>')
 	{
 	lineFileReuse(bf->lf);
 	break;
 	}
     else if (isRoundLine(line))
         parseRoundLine(line, bq);
     else if (stringIn("No hits found", line) != NULL)
         break;
     }
 
 /* Read in gapped alignments. */
 while ((bga = blastFileNextGapped(bf, bq)) != NULL)
     {
     slAddHead(&bq->gapped, bga);
     }
 slReverse(&bq->gapped);
 if (verboseLevel() >= DUMP_LEVEL)
     {
     verbose(DUMP_LEVEL, "blastFileNextQuery result:\n");
     blastQueryPrint(bq, stderr);
     }
 return bq;
 }
 
 static char *findNextGapped(struct blastFile *bf, struct blastQuery *bq)
 /* scan for next gapped alignment, return line or NULL if not hit */
 {
 while (TRUE)
     {
     if (!bfSkipBlankLines(bf))
         return NULL;
     char *line = bfNextLine(bf);
     /*
      * the last condition was added to deal with the new blast output format and is meant to find lines such as this one:
      * TBLASTN 2.2.15 [Oct-15-2006]
      * I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc
      */
     if (startsWith("  Database:", line) || (stringIn("BLAST", line) != NULL))
         {
 	lineFileReuse(bf->lf);
         return NULL;
         }
     if (line[0] == '>')
         return line;
     if (isRoundLine(line))
         parseRoundLine(line, bq);
     }
 }
 
 struct blastGappedAli *blastFileNextGapped(struct blastFile *bf, struct blastQuery *bq)
 /* Read in next gapped alignment.   Does *not* put it on bf->gapped list. 
  * Return NULL at EOF or end of query. */
 {
 char *words[16];
 int wordCount;
 struct blastGappedAli *bga;
 struct blastBlock *bb;
 int lenSearch;
 
 verbose(TRACE_LEVEL, "blastFileNextGapped\n");
 
 char *line = findNextGapped(bf, bq);
 if (line == NULL)
     return NULL;
 
 AllocVar(bga);
 bga->query = bq;
 bga->targetName = cloneString(line+1); 
 bga->psiRound = bq->psiRounds;
 
 /* Process something like:
  *      Length = 100000
  * however this follows a possible multi-line description, so be specified
  * and limit how far we can scan
  */
 for (lenSearch=0; lenSearch<25; lenSearch++)
 	{
 	line = bfNeedNextLine(bf);
         if (isRoundLine(line))
             parseRoundLine(line, bq);
 	wordCount = chopLine(line, words);
 	if (wordCount == 3 && sameString(words[0], "Length") &&  sameString(words[1], "=")
             && isdigit(words[2][0]))
 		break;
 	}
 if (lenSearch>=25)
     bfError(bf, "Expecting Length =");
 decomma(words[2]);
 bga->targetSize = atoi(words[2]);
 
 /* Get all the blocks. */
 while ((bb = blastFileNextBlock(bf, bq, bga)) != NULL)
     {
     slAddHead(&bga->blocks, bb);
     }
 slReverse(&bga->blocks);
 return bga;
 }
 
 static int getStrand(struct blastFile *bf, char *strand)
 /* Translate "Plus" or "Minus" to +1 or -1. */
 {
 if (sameWord("Plus", strand))
     return 1;
 else if (sameWord("Minus", strand))
     return -1;
 else
     {
     bfError(bf, "Expecting Plus or Minus after Strand");
     return 0;
     }
 }
 
 static boolean nextBlockLine(struct blastFile *bf, struct blastQuery *bq, char **retLine)
 /* Get next block line.  Return FALSE and reuse line if it's
  * an end of block type line. */
 {
 struct lineFile *lf = bf->lf;
 char *line;
 
 *retLine = line = bfNextLine(bf);
 if (line == NULL)
     return FALSE;
 if (isRoundLine(line))
     parseRoundLine(line, bq);
 
 /*
 the last condition was added to deal with the new blast output format and is meant to find lines such as this one:
 TBLASTN 2.2.15 [Oct-15-2006]
 I am hoping that by looking for only "BLAST" this will work with things like blastp, blastn, psi-blast, etc
 */
 if (line[0] == '>' || startsWith("Query=", line) || startsWith("  Database:", line) || (stringIn("BLAST", line) != NULL))
     {
     lineFileReuse(lf);
     return FALSE;
     }
 return TRUE;
 }
 
 static double evalToDouble(char *s)
 /* Convert string from e-val to floating point rep.
  * e-val is basically ascii floating point, but
  * small ones may be 'e-100' instead of 1.0e-100
  */
 {
 if (isdigit(s[0]))
     return atof(s);
 else
     {
     char buf[64];
     safef(buf, sizeof(buf), "1.0%s", s);
     return atof(buf);
     }
 }
 
 static boolean parseBlockLine(struct blastFile *bf, int *startRet, int *endRet,
                            struct dyString *seq)
 /* read and parse the next target or query line, like:
  *   Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488
  *
  * also handle broken NCBI tblastn output like:
  *   Sbjct: 1181YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ 1360
  *
  * Ignores and returns FALSE on bogus records generated by PSI BLAST, such as
  *   Query: 0   --------------------------                                  
  *   Sbjct: 38  PPGPPGVAGGNQTTVVVIYGPPGPPG                                   63
  *   Query: 0                                                               
  *   Sbjct: 63                                                               63
  * If FALSE is returned, the output parameters will be unchanged.
  */
 {
 char* line = bfNeedNextLine(bf);
 int a, b, s, e;
 char *words[16];
 int wordCount = chopLine(line, words);
 if ((wordCount < 2) || (wordCount > 4) || !(sameString("Query:", words[0]) || sameString("Sbjct:", words[0])))
     bfSyntax(bf);
 
 /* look for one of the bad formats to ignore, as described above */
 if (((wordCount == 2) && isAllDigits(words[1]))
     || ((wordCount == 3) && isAllDigits(words[1]) && isAllDigits(words[2]))
     || ((wordCount == 3) && isAllDigits(words[1]) && isAllDashes(words[2])))
     {
     bfWarn(bf, "Ignored invalid alignment format for aligned sequence pair");
     return FALSE;
     }
 
 /* special handling for broken output with no space between start and
  * sequence */
 if (wordCount == 3)
     {
     char *p;
     if (!isdigit(words[1][0]) || !isdigit(words[2][0]))
         bfSyntax(bf);
     a = atoi(words[1]);
     b = atoi(words[2]);
     p = words[1];
     while ((*p != '\0') && (isdigit(*p)))
         p++;
     dyStringAppend(seq, p);
     }
 else
     {
     if (!isdigit(words[1][0]) || !isdigit(words[3][0]))
         bfSyntax(bf);
     a = atoi(words[1]);
     b = atoi(words[3]);
     dyStringAppend(seq, words[2]);
     }
 s = min(a,b);
 e = max(a,b);
 *startRet = min(s, *startRet);
 *endRet = max(e, *endRet);
 return TRUE;
 }
 
 static boolean findBlockSeqPair(struct blastFile *bf, struct blastQuery *bq)
 /* scan forward for the next pair of Query:/Sbjct: sequences */
 {
 char *line;
 for (;;)
     {
     if (!nextBlockLine(bf, bq, &line))
         return FALSE;
     if (startsWith(" Score", line))
         {
         lineFileReuse(bf->lf);
         return FALSE;
         }
     if (startsWith("Query:", line))
         {
         lineFileReuse(bf->lf);
         return TRUE;
         }
     }
 }
 
 static void clearBlastBlock(struct blastBlock *bb, struct dyString *qString, struct dyString *tString)
 /* reset the contents of a blast block being accummulated */
 {
 bb->qStart = bb->tStart = 0x3fffffff;
 bb->qEnd = bb->tEnd = -bb->qStart;
 dyStringClear(qString);
 dyStringClear(tString);
 }
 
 static void parseBlockSeqPair(struct blastFile *bf, struct blastBlock *bb,
                               struct dyString *qString, struct dyString *tString)
 /* parse the current pair Query:/Sbjct: sequences */
 {
 boolean isOk = TRUE;
 
 /* Query line */
 if (!parseBlockLine(bf, &bb->qStart, &bb->qEnd, qString))
     isOk = FALSE;
 
 /* Skip next line. */
 bfNeedNextLine(bf);
 
 /* Fetch target sequence line. */
 if (!parseBlockLine(bf, &bb->tStart, &bb->tEnd, tString))
     isOk = FALSE;
 if (!isOk)
     {
     // reset accumulated data so we discard everything before bogus pair
     clearBlastBlock(bb, qString, tString);
     }
 }
 
 
 static struct blastBlock *nextBlock(struct blastFile *bf, struct blastQuery *bq,
                                     struct blastGappedAli *bga, boolean *skipRet)
 /* Read in next blast block.  Return NULL at EOF or end of gapped
  * alignment. If an unparsable block is found, set skipRet to TRUE and return
  * NULL. */
 {
 struct blastBlock *bb;
 char *line;
 char *words[16];
 int wordCount;
 char *parts[3];
 int partCount;
 static struct dyString *qString = NULL, *tString = NULL;
 
 verbose(TRACE_LEVEL,  "blastFileNextBlock\n");
 *skipRet = FALSE;
 
 /* Seek until get something like:
  *   Score = 8770 bits (4424), Expect = 0.0
  * or something that looks like we're done with this gapped
  * alignment. */
 for (;;)
     {
     if (!nextBlockLine(bf, bq, &line))
 	return NULL;
     if (startsWith(" Score", line))
 	break;
     }
 AllocVar(bb);
 bb->gappedAli = bga;
 wordCount = chopLine(line, words);
 if (wordCount < 8 || !sameWord("Score", words[0]) 
     || !isdigit(words[2][0]) || !(isdigit(words[7][0]) || words[7][0] == 'e')
     || !startsWith("Expect", words[5]))
     {
     bfError(bf, "Expecting something like:\n"
              "Score = 8770 bits (4424), Expect = 0.0");
     }
 bb->bitScore = atof(words[2]);
 bb->eVal = evalToDouble(words[7]);
 
 /* Process something like:
  *   Identities = 8320/9618 (86%), Gaps = 3/9618 (0%)
  *             or
  *   Identities = 8320/9618 (86%)
  *             or
  *   Identities = 10/19 (52%), Positives = 15/19 (78%), Frame = +2
  *     (wu-tblastn)
  *             or
  *   Identities = 256/400 (64%), Positives = 306/400 (76%)
  *   Frame = +1 / -2
  *     (tblastn)
  *
  *   Identities = 1317/10108 (13%), Positives = 2779/10108 (27%), Gaps = 1040/10108
  *   (10%)
  *      - wrap on long lines
  *
  * Handle weird cases where the is only a `Score' line, with no `Identities'
  * lines by skipping the alignment; they seem line small, junky alignments.
  */
 line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if (wordCount < 3 || !sameWord("Identities", words[0]))
     {
     if (wordCount > 1 || sameWord("Score", words[0]))
         {
         /* ugly hack to skip block with no identities */
         *skipRet = TRUE;
         blastBlockFree(&bb);
         return NULL;
         }
     bfError(bf, "Expecting identity count");
     }
 partCount = chopByChar(words[2], '/', parts, ArraySize(parts));
 if (partCount != 2 || !isdigit(parts[0][0]) || !isdigit(parts[1][0]))
     bfSyntax(bf);
 bb->matchCount = atoi(parts[0]);
 bb->totalCount = atoi(parts[1]);
 if (wordCount >= 7 && sameWord("Gaps", words[4]))
     {
     if (!isdigit(words[6][0]))
 	bfSyntax(bf);
     bb->insertCount = atoi(words[6]);
     }
 if ((wordCount >= 11) && sameWord("Frame", words[8]))
     {
     bb->qStrand = '+';
     bb->tStrand = words[10][0];
     bb->tFrame = atoi(words[10]);
     }
 
 line = bfNeedNextLine(bf);
 boolean wrapped = (startsWith("(", line));
 
 /* Process something like:
  *     Strand = Plus / Plus (blastn)
  *     Frame = +1           (tblastn)
  *     Frame = +1 / -2      (tblastx)
  *     <blank line>         (blastp)
  * note that wu-tblastn puts frame on Identities line
  */
 if (wrapped)
     line = bfNeedNextLine(bf);
 wordCount = chopLine(line, words);
 if ((wordCount >= 5) && sameWord("Strand", words[0]))
     {
     bb->qStrand = getStrand(bf, words[2]);
     bb->tStrand = getStrand(bf, words[4]);
     }
 else if ((wordCount >= 5) && sameWord("Frame", words[0]) && (words[3][0] == '/'))
     {
     // Frame = +1 / -2      (tblastx)
     bb->qStrand = (words[2][0] == '-') ? -1 : 1;
     bb->tStrand = (words[4][0] == '-') ? -1 : 1;
     bb->qFrame = atoi(words[2]);
     bb->tFrame = atoi(words[4]);
     }
 else if ((wordCount >= 3) && sameWord("Frame", words[0]))
     {
     // Frame = +1           (tblastn)
     bb->qStrand = 1;
     bb->tStrand = (words[2][0] == '-') ? -1 : 1;
     bb->qFrame = atoi(words[2]);
     bb->tFrame = 1;
     }
 else if (wordCount == 0)
     {
     /* if we didn't parse frame, default it */
     if (bb->qStrand == 0)
         {
         bb->qStrand = '+';
         bb->tStrand = '+';
         }
     }
 else
     bfError(bf, "Expecting Strand, Frame or blank line");
 
 
 /* Process alignment lines.  They come in groups of three
  * separated by a blank line - something like:
  * Query: 26429 taccttgacattcctcagtgtgtcatcatcgttctctcctccaaacggcgagagtccgga 26488
  *              |||||| |||||||||| ||| ||||||||||||||||||||||| || || ||||||||
  * Sbjct: 62966 taccttaacattcctcaatgtttcatcatcgttctctcctccaaatggtgaaagtccgga 63025
  */
 if (qString == NULL)
     {
-    qString = newDyString(50000);
-    tString = newDyString(50000);
+    qString = dyStringNew(50000);
+    tString = dyStringNew(50000);
     }
 clearBlastBlock(bb, qString, tString);
 for (;;)
     {
     if (!findBlockSeqPair(bf, bq))
         break;
     parseBlockSeqPair(bf, bb, qString, tString);
     }
 
 /* convert to [0..n) and move to strand coords if necessary */
 bb->qStart--;
 if (bb->qStrand < 0)
     reverseIntRange(&bb->qStart, &bb->qEnd, bq->queryBaseCount);
 bb->tStart--;
 if (bb->tStrand < 0)
     reverseIntRange(&bb->tStart, &bb->tEnd, bga->targetSize);
 bb->qSym = cloneMem(qString->string, qString->stringSize+1);
 bb->tSym = cloneMem(tString->string, tString->stringSize+1);
 return bb;
 }
 
 struct blastBlock *blastFileNextBlock(struct blastFile *bf, 
 	struct blastQuery *bq, struct blastGappedAli *bga)
 /* Read in next blast block.  Return NULL at EOF or end of
  * gapped alignment. */
 {
 struct blastBlock *bb = NULL;
 boolean skip = FALSE;
 
 while (((bb = nextBlock(bf, bq, bga, &skip)) == NULL) && skip)
     continue; /* skip to next one */
 
 return bb;
 }
 
 void blastFileFree(struct blastFile **pBf)
 /* Free blast file. */
 {
 struct blastFile *bf = *pBf;
 if (bf != NULL)
     {
     lineFileClose(&bf->lf);
     freeMem(bf->fileName);
     freeMem(bf->program);
     freeMem(bf->version);
     freeMem(bf->buildDate);
     blastQueryFreeList(&bf->queries);
     freez(pBf);
     }
 }
 
 void blastFileFreeList(struct blastFile **pList)
 /* Free list of blast files. */
 {
 struct blastFile *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastFileFree(&el);
     }
 *pList = NULL;
 }
 
 void blastQueryFree(struct blastQuery **pBq)
 /* Free single blastQuery. */
 {
 struct blastQuery *bq;
 if ((bq = *pBq) != NULL)
     {
     freeMem(bq->query);
     freeMem(bq->database);
     blastGappedAliFreeList(&bq->gapped);
     freez(pBq);
     }
 }
 
 void blastQueryFreeList(struct blastQuery **pList)
 /* Free list of blastQuery's. */
 {
 struct blastQuery *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastQueryFree(&el);
     }
 *pList = NULL;
 }
 
 
 void blastGappedAliFree(struct blastGappedAli **pBga)
 /* Free blastGappedAli. */
 {
 struct blastGappedAli *bga = *pBga;
 if (bga != NULL)
     {
     freeMem(bga->targetName);
     blastBlockFreeList(&bga->blocks);
     freez(pBga);
     }
 }
 
 void blastGappedAliFreeList(struct blastGappedAli **pList)
 /* Free blastGappedAli list. */
 {
 struct blastGappedAli *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastGappedAliFree(&el);
     }
 *pList = NULL;
 }
 
 
 void blastBlockFree(struct blastBlock **pBb)
 /* Free a single blastBlock. */
 {
 struct blastBlock *bb = *pBb;
 if (bb != NULL)
     {
     freeMem(bb->qSym);
     freeMem(bb->tSym);
     freez(pBb);
     }
 }
 
 void blastBlockFreeList(struct blastBlock **pList)
 /* Free a list of blastBlocks. */
 {
 struct blastBlock *el, *next;
 for (el = *pList; el != NULL; el = next)
     {
     next = el->next;
     blastBlockFree(&el);
     }
 *pList = NULL;
 }
 
 void blastBlockPrint(struct blastBlock* bb, FILE* out)
 /* print a BLAST block for debugging purposes  */
 {
 fprintf(out, "    blk: %d-%d <=> %d-%d tcnt=%d mcnt=%d icnt=%d\n",
         bb->qStart, bb->qEnd,  bb->tStart, bb->tEnd,
         bb->totalCount, bb->matchCount, bb->insertCount);
 fprintf(out, "        Q: %s\n", bb->qSym);
 fprintf(out, "        T: %s\n", bb->tSym);
 }
 
 void blastGappedAliPrint(struct blastGappedAli* ba, FILE* out)
 /* print a BLAST gapped alignment for debugging purposes  */
 {
 struct blastBlock *bb;
 fprintf(out, "%s <=> %s", ba->query->query, ba->targetName);
 if (ba->psiRound > 0)
     fprintf(out, " round: %d", ba->psiRound);
 fputc('\n', out);
 for (bb = ba->blocks; bb != NULL; bb = bb->next)
     {
     blastBlockPrint(bb, out);
     }
 }
 
 void blastQueryPrint(struct blastQuery *bq, FILE* out)
 /* print a BLAST query for debugging purposes  */
 {
 struct blastGappedAli *ba;
 for (ba = bq->gapped; ba != NULL; ba = ba->next)
     blastGappedAliPrint(ba, out);
 }